SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012548 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012548
Domain Number 1 Region: 36-370
Classification Level Classification E-value
Superfamily L domain-like 4.82e-61
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 420-504
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-20
Family I set domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012548   Gene: ENSNLEG00000010303   Transcript: ENSNLET00000013160
Sequence length 594
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:2572200:2577310:-1 gene:ENSNLEG00000010303 transcript:ENSNLET00000013160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAATAPKQAWPPWPPLLFLLLLLPAGSGGSCPAVCDCTSQPQAVLCGHRQLEAVPGGLP
LDTELLDLSGNRLWGLQRGMLSRLSLLQELDLSYNQLSTLEPGAFHGLQSLITLRLQGNR
LRIMGPGVFSGLSALTLLDLRLNQIVLFLDGAFGELGSLQKLEVGDNHLVFVAPGAFAGL
AKLSTLTLERCNLSTVPGLALAHLPALVALRLRELDIGRLPAGALRGLGQLKELEIHLWP
SLEALDPGSLVGLNLSSLAITRCNLSSVPFQALYHLSFLRVLDLSQNPISAIPARRLSPL
VRLQELRLSGACLTSIAAHAFHGLSAFHLLDVADNALQTLEETAFPSPEKLVTLRLSGNP
LTCDCRLLWLLRLRRRLDFGTSPPACAGPQHVQGKSLREFSDILPPGHFTCKPALIRKSG
PRWVIAEEGGHAVFSCSGDGDPAPTVSWMRPHGAWLGRAGRVRVLEDGTLEIRSVQLRDR
GAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVPGIPGPFFLDSRGVAMVLAVG
FLPFLTSVTLCFGLIALWSKGKGRVKHHMTFDFVAPRPSGDKNSGGNRVTAKLF
Download sequence
Identical sequences G1RH48
XP_003259301.1.23891 XP_012367031.1.23891 ENSNLEP00000012548 ENSNLEP00000012548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]