SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012552 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012552
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Immunoglobulin 1.58e-47
Family V set domains (antibody variable domain-like) 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012552   Gene: ENSNLEG00000010309   Transcript: ENSNLET00000013165
Sequence length 98
Comment pep:novel supercontig:Nleu1.0:GL397565.1:582037:591070:-1 gene:ENSNLEG00000010309 transcript:ENSNLET00000013165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMHSVRQAPGKGLEWVGRRDSGSGSTYY
PDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Download sequence
Identical sequences ENSNLEP00000012552 ENSNLEP00000012552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]