SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012616 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012616
Domain Number 1 Region: 125-314
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.52e-40
Family Laminin G-like module 0.00000000497
Further Details:      
 
Domain Number 2 Region: 330-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.65e-19
Family Laminin G-like module 0.000000102
Further Details:      
 
Domain Number 3 Region: 20-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000475
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 59-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000994
Family EGF-type module 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012616
Domain Number - Region: 2-25
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00266
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 109-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0394
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012616   Gene: ENSNLEG00000010348   Transcript: ENSNLET00000013237
Sequence length 501
Comment pep:known_by_projection supercontig:Nleu1.0:GL397832.1:51356:80251:1 gene:ENSNLEG00000010348 transcript:ENSNLET00000013237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNFFCLCKAGWGGRLCDKDVNECSQENGGCLQICHNKLGSFHCSCHSGFELSSDGRTCQ
DIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACQDVDECLQGRCEQVCVNSPG
SYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSVKSLYLGRMFSGTPVIRLRFKRLQP
TRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGRLELQLRYNGVGRVTSSGPVINH
GMWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQPERGLYHLNLTVGGIPFHEKDLVQP
INPRLDGCMRSWNWLNGEDTTIHEAVKVNARMQCFSVTERGSFYPGSGFAFYSLDYVRTP
LDVGTESTWEIDVVAHIRPAADTGVLFALWVPDLRAVPLSVALVDYHSTKKLKKQLVVLA
VEHVALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSATQLQERLARAREALR
SPVLTFAGGCQVGAPCSTHLG
Download sequence
Identical sequences ENSNLEP00000012616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]