SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012653 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012653
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily EF-hand 1.3e-23
Family S100 proteins 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012653   Gene: ENSNLEG00000010395   Transcript: ENSNLET00000013276
Sequence length 101
Comment pep:novel supercontig:Nleu1.0:GL397275.1:4182063:4183472:1 gene:ENSNLEG00000010395 transcript:ENSNLET00000013276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNTQAETSVIGMIDMFHKYTRRNDKIDKPSLLTMMKENFPNFLSACDKKGTNYLANVFE
KKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Download sequence
Identical sequences G1RHF3
XP_004089944.1.23891 XP_004089945.1.23891 ENSNLEP00000012653 ENSNLEP00000012653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]