SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012731 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012731
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily DEATH domain 2.91e-34
Family DEATH domain, DD 0.0034
Further Details:      
 
Domain Number 2 Region: 96-186
Classification Level Classification E-value
Superfamily DEATH domain 0.00000494
Family DEATH domain, DD 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012731   Gene: ENSNLEG00000010467   Transcript: ENSNLET00000013357
Sequence length 208
Comment pep:known_by_projection supercontig:Nleu1.0:GL397426.1:900915:905134:1 gene:ENSNLEG00000010467 transcript:ENSNLET00000013357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFLVLLHSVSSSLSSSELTELKFLCLGRLAKRKLERVQSGLDLFSLLLEQNDLEPGRT
ELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK
VSDTKIDNIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRACQMNLVADLVQEV
QQARALQDRSGAMSPMSWNSDASTSEAS
Download sequence
Identical sequences G1RHN0
XP_003278072.1.23891 ENSNLEP00000012731 ENSNLEP00000012731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]