SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012745 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012745
Domain Number 1 Region: 1331-1441
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-33
Family PDZ domain 0.00000337
Further Details:      
 
Domain Number 2 Region: 1737-1916
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.37e-28
Family Nucleotide and nucleoside kinases 0.00014
Further Details:      
 
Domain Number 3 Region: 1493-1583
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-17
Family PDZ domain 0.0093
Further Details:      
 
Domain Number 4 Region: 720-792
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-16
Family PDZ domain 0.028
Further Details:      
 
Domain Number 5 Region: 1594-1662
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000853
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 6 Region: 1-89
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000465
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 
Domain Number 7 Region: 598-709
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000905
Family PDZ domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012745   Gene: ENSNLEG00000010435   Transcript: ENSNLET00000013371
Sequence length 1919
Comment pep:known_by_projection supercontig:Nleu1.0:GL397364.1:313612:452776:-1 gene:ENSNLEG00000010435 transcript:ENSNLET00000013371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLKLL
LAKERDHFQDLRAALEKTQPHLLPILYLNGVVGPPQPAEGAGSTYSVLSTMPSDSESSSS
LSSVGTTGKAPSPPPLLTDRQVNEKVENLSIQLRLMTRERNELRKRLAFATHGTAFDKRP
YHRLNPDYERLKIQCVRAMSDLQSLQNQHTNALKRCEEVAKETDFYHTLHSRLLSDQTRL
KDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKEIGDLRAQQQQVGPAPGDWPFLP
TLHPGILGPLAFVRRGVDAWLASLTEKPTEECSDQCRVQVGGENRSWLEAAAQPATDRAG
PPPLPRLAASLARFEAIHHELNKATAQNKDLQWEMELLQSELTELRTTQVKTAKESEKYR
EERDAVYSEYKLIMSERDQVISELDKLQTEVELAESKLKSSTSEKKAANEEMEALRQLSS
AVNLEAGLANKEVEILRKQCKALCQELKEALQEADVAKCRRDWAFQERDKIVAERDSIRT
LCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLMAH
SSHDSAIDTDSMEWETEVVEFERETEDIDLKALGFDMAEGAPTPWHGGRLAAGPTAYVGA
ELAVPLLRVNDWLLRINDVDLINKDKKQAIKALLNGEGAINMVVRRRKSLGGKVVTPLHI
NLSGQKDSGISLENGVYAAAVLPGSPAAKEGSLAVGDRIVAINGIALDNKSLNECESLLR
SCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDKMLSFRAHGPEVQAHNKRNLIQHNNST
QTDIFYTDRLEDRKEPGPPGGSSSFLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGD
RGFGLVDVRGRRPLLPFETEAGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLS
VYKKPKQRKSIFDPNTFKRPQTPPKIDYLLPGPGPAHSPQLSKRAGPLTPPKPPRRSDSI
KFQHRLETSSESEATLVGSSPSTSPPSALPPDVDPGEPMHASPPRKARVRIASSYYPEGD
GDSSHLPAKKSCDEDLTSQKVDELGQKRRRPKSAPSFRPKLAPVVIPAQFLEEQKCVPAS
GELSPELQEWAPYSPGHSSRHSNPPLYPSRPSVGTVPRSLTPSTTVSSILRNPIYTVRSH
RVGPCSSPPAARDAGSQGLHPSVQHQGRLSLDLSHRTCSDYSEMRATHGSNSLPSSARLG
SSTNLQFKAERIKIPSTPRYPRNVVGSDRGSVSHSECSTPPQSPLNIDTLSSCSQSQTSA
STLPRIAVNPASLGERRKDRPYVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTVGSI
AHQAGLEYGDQLLEFNGINLRSATEQQARLIIGQQCDTITILAQYNPHVHQLSSHSRSSS
HLDPAGTHSTLQGSGTTTPEHPCVIDPLMEQDEGPSTPPAKQSSSRIVGDANKKTLEPRV
VFIKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLILEYGSLDVRNKTVEE
VYVEMLKPRDGIRLKVQYRPEEFTKAKGLPGDSFYIRALYDRLADVEHELSFKKDDILYV
DDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNSATKTLSA
AARRSFFRRKHKHKRSGSKDGKDLLALDAFSNDSIPLFEGKDSVSLAYQQVQKVDCTALR
PVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDV
TTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDK
VTQRHSKEQFEAAQKVEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL
Download sequence
Identical sequences ENSNLEP00000012745 ENSNLEP00000012745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]