SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012795 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012795
Domain Number 1 Region: 119-219
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-23
Family I set domains 0.00037
Further Details:      
 
Domain Number 2 Region: 221-309
Classification Level Classification E-value
Superfamily Immunoglobulin 3.55e-16
Family I set domains 0.00022
Further Details:      
 
Domain Number 3 Region: 28-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000177
Family I set domains 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012795   Gene: ENSNLEG00000010508   Transcript: ENSNLET00000013422
Sequence length 365
Comment pep:known_by_projection supercontig:Nleu1.0:GL397560.1:111430:122134:1 gene:ENSNLEG00000010508 transcript:ENSNLET00000013422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKLFTLLCLGFCLNQKICTHAGAQFKLSLSAWPSPVVPLGGRVTLSCHPRLRFVILTI
VQTTGTRIRELHAGLSNNITISPVTPGHAGTYKCVGIYKHTSKWSAESSSLKIIVTGLFT
KPSISAHPNILVHVGARVSLRCHSELAFDEFVLYKDGHIQHSQQLDEGMEAGIHYVEAVF
SVGPVTPAHAGAYRCCGCFSHSSYEWSAPSDPLDIVITGKYKKPSLSTHVDPMMRLGEKL
TFFCSSEISFDWYHLFRDGVAHGQWRSGGWRCSGAFQANFSVGPAMPVPGGTYRCYGSFN
DSPYEWPPVTHCTFISETLRVLLCHSRNPPLNLTPPWQTQRPWKANGRMKRSLQQKRRRR
SCMPS
Download sequence
Identical sequences ENSNLEP00000012795 ENSNLEP00000012795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]