SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012828 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012828
Domain Number 1 Region: 321-418
Classification Level Classification E-value
Superfamily Immunoglobulin 2.27e-28
Family I set domains 0.00053
Further Details:      
 
Domain Number 2 Region: 25-118
Classification Level Classification E-value
Superfamily Immunoglobulin 6.1e-26
Family I set domains 0.0000471
Further Details:      
 
Domain Number 3 Region: 120-219
Classification Level Classification E-value
Superfamily Immunoglobulin 1.66e-24
Family I set domains 0.000012
Further Details:      
 
Domain Number 4 Region: 222-318
Classification Level Classification E-value
Superfamily Immunoglobulin 1.86e-24
Family I set domains 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012828   Gene: ENSNLEG00000010527   Transcript: ENSNLET00000013458
Sequence length 483
Comment pep:known_by_projection supercontig:Nleu1.0:GL397560.1:149675:162372:1 gene:ENSNLEG00000010527 transcript:ENSNLET00000013458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPILRVLICLGLSLGRRTHVQAGPLPKPTLWAEPGSVINQGSPVTLRCQGSLQAEEYHL
YRENKSASWVRWIQEPGKKGQFPIPSITWEHAGRYRCQYYSHNHSSEPSDPLKLVVTGAH
SKPTLSALPSPVVTSGGNVTLQCGSQVAFDRFILCKEGEDEHLQRLNSHSHARGWSWAVF
SVGPVSPSRRWSYRCYAYDSRSPYVWSSPSDLLELLVPGVSKKTSLSVKPGPVVAPGESL
TLQCGSDVSYDRFVLYKEGERDFLQFLGRQPQAGLSQANFTLSPASRSHGGQYRCYGAHN
LSSEWSAPSDPLDILITGQFYDTVSLSVQPGPTVASGEKVTLLCQSWGQFHTFLLTKEGT
AHPPLRLRSENQAQQNQAEFPMAPVTSAHAGTYRCYSSLSSNPYLLSHPSDPLELVVSEA
AETLSPSQNKTDSMTTSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDA
VGR
Download sequence
Identical sequences G1RHX6
ENSNLEP00000012828 ENSNLEP00000012828 XP_003281688.2.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]