SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012870 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012870
Domain Number 1 Region: 110-216
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-17
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 214-309
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000459
Family Fibronectin type III 0.00015
Further Details:      
 
Domain Number 3 Region: 32-100
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000479
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012870   Gene: ENSNLEG00000010517   Transcript: ENSNLET00000013503
Sequence length 422
Comment pep:known_by_projection contig::ADFV01136734.1:9987:17941:1 gene:ENSNLEG00000010517 transcript:ENSNLET00000013503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSCSGLSRVLVAVATALVSASSPCSQAWGPPGVQYGQPGRSMKLCCPGVTAGEPVSWF
RDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICRTLDGALGGTVTLQLGYPSARPVVSC
QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRKSLSTGPWPCPQDPLGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSMVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSTWSPEAWGTPSTGTVPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHK
DSVEQVAVLASLGILSFLGLVAGALALGLWLRLRQGGKDGSPKPGFLASMIPVDRHPGAP
NL
Download sequence
Identical sequences H9HA20
ENSNLEP00000012870 XP_003282499.1.23891 ENSNLEP00000012870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]