SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012880 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012880
Domain Number 1 Region: 19-88,126-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000256
Family I set domains 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012880   Gene: ENSNLEG00000010592   Transcript: ENSNLET00000013513
Sequence length 272
Comment pep:known_by_projection supercontig:Nleu1.0:GL397396.1:49776:64918:-1 gene:ENSNLEG00000010592 transcript:ENSNLET00000013513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFHILSSFVPTEHSSMLVEKNITLERPSNVNLTCQFTASGDLNAVNVTWKKDGEQLENNY
LVSATGSTLYTQYRFTIINSKQMGSYSCFFREEKEQRGTFNFKVPELHGKNKPLISYVGD
SAVLTCKCQNCFPLNWTWYSSNGSVKVPVGVQMNKYVINGTYANETKLKITELLEEDGGS
YWCRALFQLGESEEHVELVVLSYLVPLKPFLAIVAEVVLLVATILLCEKYTQKKKKHSDE
GKEFEQIEQLKSDDSNGIENVPRRRKNESLGQ
Download sequence
Identical sequences ENSNLEP00000012880 ENSNLEP00000012880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]