SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012881 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012881
Domain Number 1 Region: 11-156
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-29
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 2 Region: 1391-1495
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 9.46e-29
Family Lipoxigenase N-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012881
Domain Number - Region: 261-341
Classification Level Classification E-value
Superfamily PKD domain 0.000536
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012881   Gene: ENSNLEG00000010482   Transcript: ENSNLET00000013514
Sequence length 2465
Comment pep:novel supercontig:Nleu1.0:GL397346.1:1815750:1946837:-1 gene:ENSNLEG00000010482 transcript:ENSNLET00000013514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVGLVLLVLALRLRATTAKPEEGSFCSKSQVAFRDACYEFVPLGRTFREAQSWCEGQG
GHLVFIQDEGTQRFLQKHISQDREWWIGLTWNLAPNGTTEGSGTWLDTSNVTYSNWHGGQ
ATTAPDTCGHIGRGPSSEWVASDCAQTFAFMCEFRVGQSLACEGLNATMHCGSGQVIQVQ
DAVYGRQNPHFCTQDAGRPSDLEQGCSWANVKDEVAGQCQGLQACQAAADETYFGNLCPT
QGSYLWVRYQCREALQLVVSSESFVFDNVTISLTWLLSPYIGNLSCIISAGDGHTFDPYN
PPSVSSNVTHQFTSLGEFTVFAECTTSEWHVTAQRQVTVQDKMERLSVTACSGLSPSGAG
PLCQAVFGDPLWIQVELDGGTGVTYTVLSGDITLAESTTQKGSLLYNLTLDRETQKLMGP
GRHSLEIQATSNTTTSTISRNITVHLVELLSGLQASWASDHLELGQDLLINISVAQGTPE
ELTFEVAGLNATFSHEQVSFGEPFGIYRLAVPVEGTFLVTILVRNAFSNLSLEIGNITIT
APSGLQEPSGMNTEGKNKDKGDMEVYIQPGPYVDPFTTVTLDWPDNDKELRFQWSCGHCW
TQWSGCVERQLLRPDQRELVVPASCLPPPDSAVTLRLAVLRGQELENRAEQCLYVSAPQE
LRPRVSCERNCRPVNASEDILLSVTMGEDSPVAMFSWYLGNTPTEQAEPLPDACRLRGFW
PRSLTLLQGNTSTLLLNSSLLQSWGEVIRIRATALTMHAYGEDTYVISTLPPPEVPACTI
APEEGTVLTSFAIFCNASTALGPLEFCFCLESGSCLHCGPEPVLPSVYLPLGKENNDFVL
TVVISATNRAGDTQQTEAVAKVALGDTCVEAVAFQAAVSEKIPTALPGEGGPEQLLQLAK
AVSSVLNREHDNQGSGQSLSVDVRQKVREHVLGSLSAVTASLEDMQRVQELAEVLREVTC
RSKELTPSAQWEASLALQHASEALLTVSAKARPEDQRRQAATRDLFQAVGSVLEASLSNR
PEEPAEASSSQIVTVPRLLGVVEHVQTTLLLGKLPGSLPAMLATPSISVYTNRIQPRSWQ
GSSLRTDAADSATFTLPAASSLGSLEASQEPVDIKMMSFPKSPFAARSHFDVSGTVGGLR
VTSPSGQLIPVKNLSQNIEILLPWHSQGHSQPTTLNLSSPETLWVNVTSGAATLGIQLHR
PDIALTLSLGYGYHPNKSSYDAQTHLVRMAAPDELPTWILSPQDLRFGEGVYYLTVVPES
DLEPAPGRDLTVGITTFLSHCVFWDEVQETWDDSGCQVGPQTSPYQAHCLCNHLTFFGST
FLVMPNAIDIHQTAELFGTFENNPVVVTTVGCLCVVYVLVVIWARRKDAQDQAKVKVTVL
EDNDPFAQYHYLVTVYTGHRRGAATSSKVTVTLYGLDGESEPHHLSAPDTAVFERGAVDA
FLLSTLFPLGELQSLRLWHDNSGDRPSWYVSRVLVYDLARDRKWYFLCNSWLSIDVGDCV
LDKVFPVATEQDRKQFSHLFFMKTSTGFQDGHIWYSVFSRCARSRFTRVQRVSCCFSLLL
CTMLTSIMFWGVPKDPAEQKMDLGKIELTWQEVMIGLESSILMFPINLLIVQIFRNTRPR
VAKEQNTGKWDRGSPNVTPSPQPVEDGLLTPEAVTKDVSRIVSSLFKALKVPSPALGWDS
VNLMDINSLLALVEDVICPQNTSGQVFWEEAKKREDPVTLTLGSSQMKEKSQNPKPKAAR
RGPWKDSAYRQCLYLQLENVEQELRLVGPRGFPQPHSHARALRQLQTLKGGLGVQPGTWA
PTHASALRVSKPPQGLPWWCILVGWLLVAATSGVAAFFTMLYGLHYGKASSLRWLISMAV
SFVESVFVTQNPEVLGFAAFFALVLKRVDDEEDTVAPLPGHLLGPDPYALFRARRNSSRD
VYQPPLTAAIEKMKTTHLKEQKAFALIREILAYLGFLWMLLLVAYGQRDPSAYHLNRHLE
HSFTRGFSDVLGFQEFFEWANATLVSNLYGHPPGFITDGNSRLVGSAQIRQVRVRESSCP
VAQQLQASLSGCRAPYSLDAEDLADYGEGWNATALSNGSSFPQAWQYHSQDQRRGYPIWG
KLTVYRGGGYVVPLGTDRQSASRILRYLFDNTWLDALTRAVFVEFTVYNANVNLFCIVTL
TLETSALGTFFTHAALQSLRLYPFTNSWHPFVVTAELIYFLFLLYYMVVQGKRMRKQTWG
YFRSKWNLLEVAIILASCSALAVFVKRAVLAERDLQRCRNHREEGISFGETAAADAALGY
IIAFLVLLSTVKLWHLLRLNPTMNMITAALCHAWGDISGFIIFILTMLLAYSIASNLIFG
WKLRSYKTLFDAAETMISLQLGIFNYEEVLDYSPVLGSFLIGSCIVFMTFVVLNLFISVI
LVAFSEEQKFNQPSEEGEIVDLLLMKILSFLGIKCKREEPGSSREQPGSLSQTRRSQLAQ
ALPKV
Download sequence
Identical sequences ENSNLEP00000012881 ENSNLEP00000012881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]