SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012889 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012889
Domain Number 1 Region: 24-104
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000341
Family DEATH effector domain, DED 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012889   Gene: ENSNLEG00000010600   Transcript: ENSNLET00000013522
Sequence length 326
Comment pep:known_by_projection supercontig:Nleu1.0:GL397519.1:134608:154284:-1 gene:ENSNLEG00000010600 transcript:ENSNLET00000013522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSGSTPAPCWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLA
RARSGLELLLELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYSYGTS
SSSKRTEGSCRRRRQSSSSANSQQGQWETGSPPTKRQRRSRGRPSGGARRRRRGAPAAPQ
QQPEPTRPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQATAVLR
SRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVRLLVSVD
EADYEAGRRRLLLMEEEGGRRPTEAS
Download sequence
Identical sequences M3Z911
ENSNLEP00000012889 ENSNLEP00000012889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]