SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Nomascus leucogenys 76_1.0 > ENSNLEP00000012893

Domain assignment for ENSNLEP00000012893 from Nomascus leucogenys 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSNLEP00000012893
Domain Number 1	Region: 123-216
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	6.42e-22
Family	I set domains	0.00000464
Further Details:

Domain Number 2	Region: 24-120
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	5.1e-17
Family	I set domains	0.00000475
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSNLEP00000012893 Gene: ENSNLEG00000010588 Transcript: ENSNLET00000013526
Sequence length	286
Comment	pep:known_by_projection supercontig:Nleu1.0:GL397560.1:301854:313501:1 gene:ENSNLEG00000010588 transcript:ENSNLET00000013526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MDPKETTLLCLVLCLGQRIQAQEGDSPMPFISAKSSPVIPLGGSVKIECQAIREAYLTQL MILKNSTYQEIGRRLKFWNETNPDFIVNHMDANKAGRYQCQYRIGHYRFRYSDTLELVVT GLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPRHQSGEHPANFSL GPVGLNVSGIYRCYGWHHRSPYLWSFPSNALELAVTVKRGKDSPTPGQGRENGFPTTLST FTSSLELYRHHKALNKEASADVAETSWNQQMCQPGLTFARTPSVCK
Download sequence
Identical sequences	ENSNLEP00000012893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]