SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012918 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012918
Domain Number 1 Region: 120-212
Classification Level Classification E-value
Superfamily Immunoglobulin 3.93e-21
Family I set domains 0.00000397
Further Details:      
 
Domain Number 2 Region: 26-118
Classification Level Classification E-value
Superfamily Immunoglobulin 4.02e-20
Family I set domains 0.00000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012918   Gene: ENSNLEG00000010611   Transcript: ENSNLET00000013554
Sequence length 363
Comment pep:known_by_projection supercontig:Nleu1.0:GL397560.1:324441:329560:1 gene:ENSNLEG00000010611 transcript:ENSNLET00000013554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQL
HFEGSLFAVERPKPPERINKVKFYILAMNSRTAGQYSCIYRVGELWSEPSNWLDLVVTEM
YDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEERSTHVQRGYGKVQAEFPLGPV
TTAHRGTYRCFGSYNKHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADPWDTYLVTTET
GLQEDHALWDHTAQNFLRMGLAFLVLVALVWFLVEDWLGRKRTRERASRASTWEGRRRPN
TKTLKNDHETQWPWVELKAGVEPGRRERCVGPMEEGVTAGNKGHWHAICQSFPDNAEGGR
TTC
Download sequence
Identical sequences ENSNLEP00000012918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]