SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012943 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012943
Domain Number 1 Region: 102-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-60
Family SPRY domain 0.0000000327
Further Details:      
 
Domain Number 2 Region: 17-90
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000021
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012943   Gene: ENSNLEG00000010648   Transcript: ENSNLET00000013579
Sequence length 298
Comment pep:novel supercontig:Nleu1.0:GL397411.1:501628:505634:1 gene:ENSNLEG00000010648 transcript:ENSNLET00000013579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEARGETPEGETFAMAQHFKQVIRCPVCLKDLEDAVQLKCGYVCCLPCLNSLQKEPDGEG
LLCRCCSVVSQKNDIKPKYKLRAMVSIIKELEPKLKRILTMNPRMRKFQVDMTLDVDTAN
NYLIISEDLRSVRSGDSSQNRKEQAERFDTALCVLGAPRFTSGRHYWEVDVGTSKIWDVG
ICKESVNRQGQIVLSSEQGFLTVGCRNGNIFAASTMPMTPLWVSPQLHRVGIFLDVGMRS
ISFFHVGDGSHIYTFSKIPDCEPWRPFFAQKRGTQDDQSILSICSVSNAASAGAPVDS
Download sequence
Identical sequences ENSNLEP00000012943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]