SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012951 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012951
Domain Number 1 Region: 88-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-60
Family SPRY domain 0.000000288
Further Details:      
 
Domain Number 2 Region: 3-73
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000127
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012951   Gene: ENSNLEG00000010656   Transcript: ENSNLET00000013587
Sequence length 270
Comment pep:novel supercontig:Nleu1.0:GL397411.1:513414:514731:1 gene:ENSNLEG00000010656 transcript:ENSNLET00000013587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHFKEASSCPICLDYLENPMHLKCGYICCLRCMNSLRKGPHGKGVLCPFCHVVFQKND
IRPAAQLGALLSKSKELEPKLRAALQMNPRMRKFQVDMTLDVDTANNYLIISEDLRRVCG
NFRQNRKEQAERFDSALCVLGAPRFTSGRHYWEVDVGTSKVWDVGVCKESVNRQGNVVLS
SELGFWTVGLREGQIYFASTKPVTGLWVSPGLHRVGIYLDTKMRIISFYNVSDRSHIFTF
TKISATEPLRPCFAHADTSRDDHGYLSVCV
Download sequence
Identical sequences ENSNLEP00000012951 ENSNLEP00000012951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]