SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012957 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012957
Domain Number 1 Region: 602-843
Classification Level Classification E-value
Superfamily RNI-like 6.28e-31
Family 28-residue LRR 0.00042
Further Details:      
 
Domain Number 2 Region: 6-93
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-21
Family Pyrin domain, PYD 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012957
Domain Number - Region: 205-291,326-377
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0717
Family Nucleotide and nucleoside kinases 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012957   Gene: ENSNLEG00000010661   Transcript: ENSNLET00000013593
Sequence length 844
Comment pep:known_by_projection supercontig:Nleu1.0:GL397560.1:369969:398401:1 gene:ENSNLEG00000010661 transcript:ENSNLET00000013593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSPAPMGFNLPALLEQLSQDELSKFKSLITTVSLANELQKIPHKEVDKADRKQLAEILT
SHCHSYWVEMATIQVFEKMHRMDLSESAKDELREAALKSFNKNKPLSLGVTRKERPPLDL
EEMLERFKAEALAFTETEEDVTCLTKEVFKGEKPDNRYRYILKTKFREMWKSWPGDSKEV
QVMAERYKMLIPFSNPRVLPGPFSYTVVLHGPAALGKPRWAQKLMLDWEDNLTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXELQDDIPHILAQAQKILFVIDGFDELGAPPGALIQ
DICGDWEKKKPVPVLLGSLLKRSMLPKAGLLVTTRSRALRDLRLLAEEPIYIRVEGFLEE
DRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDLAPTC
LTRTELFLRFLCSRFPQGAQLRGALRKLSLLAAQGLWAQMSVLHREDLERLGVQESDLRP
FLDGHILRQDTVSKGCYSFIHLSFQQFLAALFYALEKEEEEDRDGHAWDIGDVQKLLSGG
ERLRNPDLIQAGYYSFGLANERRAKELEATFGCRISPDIKQELLRCDVSCKGGHSTMTDL
KELLGCLYESQEEELVKEVMAQFKEISLHLNAVDVVPSSFCVKHCRNLQKMSLQVIKAEL
PENVTVSESDAEAERSQDDEHVLPFWTDLCSIFGSNKDLMGLTINNSFLSASLVRILCEQ
IASDTCHLQRVVFKNISPADALRNLCLALRAHKTVTYLTLQGNDQNDMLPTLCEVLRHPE
CNLRYLGLWGCSIPPFSCEDLCSALSCNQSLVTLDLGQNPLGSSGVKMLFETLTRPNGTL
QTLR
Download sequence
Identical sequences ENSNLEP00000012957 ENSNLEP00000012957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]