SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012962 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012962
Domain Number 1 Region: 111-204
Classification Level Classification E-value
Superfamily Immunoglobulin 1.89e-27
Family I set domains 0.00051
Further Details:      
 
Domain Number 2 Region: 25-109
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-18
Family I set domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012962   Gene: ENSNLEG00000010669   Transcript: ENSNLET00000013598
Sequence length 221
Comment pep:known_by_projection supercontig:Nleu1.0:GL397560.1:410095:420059:-1 gene:ENSNLEG00000010669 transcript:ENSNLET00000013598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSPTALLCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLE
KLSSSSYQDQAVLFIPAMKTHLAGRYRCSYQNRSLWSLPSDQLELVATGVFAKPSLSAQP
GPAVSSGGDVTLQCQTQEGFDQFALYKEGDPAPYKNSERWYRASFPIITVTAAHSGTYRC
YSFSSGNPYLWSAPSDPLELLVTGTSVTPSLLPTEPPSSVA
Download sequence
Identical sequences ENSNLEP00000012962 ENSNLEP00000012962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]