SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012963 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012963
Domain Number 1 Region: 659-1072
Classification Level Classification E-value
Superfamily RNI-like 1.7e-67
Family 28-residue LRR 0.0000103
Further Details:      
 
Domain Number 2 Region: 109-194
Classification Level Classification E-value
Superfamily DEATH domain 2.24e-19
Family Pyrin domain, PYD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012963   Gene: ENSNLEG00000010660   Transcript: ENSNLET00000013599
Sequence length 1130
Comment pep:known_by_projection supercontig:Nleu1.0:GL397411.1:521914:567034:-1 gene:ENSNLEG00000010660 transcript:ENSNLET00000013599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCGLSSNQQTLLSPGWRKTTGASGQKHAGAAVFPLHREGQQEPTLANQERSQLANHGAG
TAFFFPLPGLFAFDRPRRPGGRVDLIFLVPQNPFSEVCLPWRSKMAESDSTDFDLLWYLE
NLSEKEFQSFKKYLARKILDFKLPQVPVIQMTKEELANVLPISYEGQYIWNMLYSIFLMM
RKEDLCRKIIRRRNRNQETCKALMRRKFMLQWESHTFGEFHYKFFCDVTSDVFYILQLAY
DSTSCYSANDLNVFLVGDRASGKTMVIYLAVSRWIKGEMWQNMISYVVHLTSHEINQMPN
SSLAELIAKDWPEGQAPIADILSDPKKLLFIIEDLDNVRFELNVNESALCSNSTQKVPIP
ILLVSLLKRKMAPGCWFLISSRPTSKDNVKLFLKETDCYTTLQLSNEKREIYFNSFFKDR
QRASAALKLVHEDEILVGLCRVAILCWITCTVLNRQMDKGRDFQLCCQTPTDLHAHFLAD
ALTSEAGLTANQYHLGLLKRLCLLAAGGLFLSTLNFSGEDLRCVGLTEVDVSVLQAANIL
LPSSTHKSRYKFIHLNVQEFCAAIAFLMAVPNCLIPSGGREYKEKREQCSDFNQVFTFIF
GLLNENRRKILETSFGYQLPLVGSFRWYSLSVQRIFQNKEPLTSDLLCFCLNSKFELNLS
TVDILGQLFFNMESPATLVDLNVVHSCLTLLYFLLHVESIPLENSILLLCSQMKSLVYWR
EICSLFYTMESLRELHIFDNDLNDISERILSKALEHSSCKLRTLKLSYVSTASGFEELLK
ALAHNRSLTYLSLNCTSISVNMFSLLHEILDEPTCQISHLSLMKCDLRASECEEIASLLV
NGGSLRKLTLSNNPLRSDGVNILCDALLHPNCTLISLVLVFCCLTENCCSSLGRVLLLSP
TLKQLDLCVNHLKNYGVLHVTFPLIFPTCQLEELHLSGCFFSSDICQYIAIVIATNEKLR
SLEIGSNSIEDAGMQLLCGGLRHPNCMLVNIGLEECMLTSACCRSLASVLTTNKTLERLN
LLQNHLGNEGVVKLLESLIRPDCVLKVVGLPLTGLSTQTQQLLMTVKERKPNLIFLSETW
SLKEGREIGVTPASQPGSIIPNSNLDYMFFKFPRMSAAMRTSNTASRQPL
Download sequence
Identical sequences ENSNLEP00000012963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]