SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012970 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012970
Domain Number 1 Region: 343-413
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.53e-22
Family Intermediate filament protein, coiled coil region 0.00093
Further Details:      
 
Domain Number 2 Region: 102-135
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000152
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012970
Domain Number - Region: 71-106,147-153,411-431
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0628
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012970   Gene: ENSNLEG00000010672   Transcript: ENSNLET00000013607
Sequence length 449
Comment pep:novel supercontig:Nleu1.0:GL397460.1:266043:270050:-1 gene:ENSNLEG00000010672 transcript:ENSNLET00000013607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSFYSSSSCPLGCTMAPGARNASVSPIDVGCQPGAEANAASMCLLANVAHANRVRVGST
PLGRPSLCLPPTCHTACPLPGTCHIPGNIGICGAYGKNTLNGHEKETMQFLNDRLANYLE
KVRQLEQENAELEATLLERSKCHESTVCPDYQSYFRTIEELQQKILCSKAENARLIVQID
NAKLAADDFRIKLESEHSLRQLVEADKCGTQKLLDDATLAKADLEAQQESLKEEQLSLKS
NHEQEVKILRSQLGEKLRIELDIEPTIDLNRVLGEMRAQYEAMLETNRQDVEQWFQAQSE
GISLQAMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCEAEDRFGTELA
QMQSLISNVEEQLSEIRADLERQNQEYQVLLDVKARLENEIATYRNLLESEDCKLPCNPC
STPASCTSCPSCGPVTGGSPSGHGASMGR
Download sequence
Identical sequences G1RIB4
ENSNLEP00000012970 XP_003279470.1.23891 ENSNLEP00000012970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]