SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012978 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012978
Domain Number 1 Region: 261-375
Classification Level Classification E-value
Superfamily C-type lectin-like 2.75e-32
Family C-type lectin domain 0.000000999
Further Details:      
 
Domain Number 2 Region: 220-258
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000000000000015
Family Triple coiled coil domain of C-type lectins 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012978   Gene: ENSNLEG00000010686   Transcript: ENSNLET00000013615
Sequence length 375
Comment pep:known_by_projection supercontig:Nleu1.0:GL397364.1:2448316:2458303:1 gene:ENSNLEG00000010686 transcript:ENSNLET00000013615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLLSALVLLTQPLGYLEAEMKTYSQRTAPSACTLVMCSSAESGLPGRDGRDGREGPR
GEKGDPGSAGAVGPQGSPGARGPPGLKGDKGVPGDKGAKGESGLPGPPGPPGVPGPAGRE
GPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGPAGPKGERGIPGERGAPGNA
GAAGSAGAVGPQGSPGARGPPGLKGDKGVPGDKGAKGESGLPDVASLRQQVEALQVQVQH
LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLVCTQAGGQLASPRSAAENAAL
QQLVIAQNEAAFLGMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKW
NDRACGEKRLVVCEF
Download sequence
Identical sequences G1RIC2
ENSNLEP00000012978 XP_003274560.1.23891 ENSNLEP00000012978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]