SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012991 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012991
Domain Number 1 Region: 157-271
Classification Level Classification E-value
Superfamily C-type lectin-like 1.22e-30
Family C-type lectin domain 0.00000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012991   Gene: ENSNLEG00000010694   Transcript: ENSNLET00000013628
Sequence length 271
Comment pep:novel supercontig:Nleu1.0:GL397364.1:2489957:2492760:-1 gene:ENSNLEG00000010694 transcript:ENSNLET00000013628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAEVADGLMAIPPAGAATGARAMWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPG
SHGLPGRDGRDGVKGDPGPPGPMGPPGDMQCPSGNDGLPGAPGVPGECGEKGEPGERGPP
GLPAHLDEXXXXXXXXXXXIRTLLLSALSLQGSIMTIGEKIFSTNGQSVTFDAIQEACAR
AGGRIAVPRSPEENEAIASFVKKYNTYAYVGLTEGPRPGDFRYSDGTPVNYTNWYPGEPA
GRGKEQCVEMYTDGQWNDRNCLQYRLTICEF
Download sequence
Identical sequences ENSNLEP00000012991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]