SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013004 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013004
Domain Number 1 Region: 334-405
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.96e-22
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 2 Region: 94-129
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000575
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Domain Number 3 Region: 12-73,404-446
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000298
Family Growth factor receptor domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000013004
Domain Number - Region: 207-321
Classification Level Classification E-value
Superfamily Prefoldin 0.000288
Family Prefoldin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013004   Gene: ENSNLEG00000010704   Transcript: ENSNLET00000013641
Sequence length 448
Comment pep:known_by_projection supercontig:Nleu1.0:GL397460.1:302934:310915:-1 gene:ENSNLEG00000010704 transcript:ENSNLET00000013641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSCCVTNNLQASLKSCPRPASVCSSSVNCRPELCLGYVCQPMACLPSVCMPTTFQPAS
CLSKTYLSSSRRTASGISGSMGPGSWYREGAFNGNEKETMQFLNDRLASYLTRVRQLEQE
NAELESRIQEASHSQVLTMTPDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADD
FRAKYEAELAMRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELMCLKKNHEEEVSS
LRCQLGDRLNIEVDAAPPVDLTRVLEEMRCQYETLVEANRRDVEEWFNTQMEELNQQVAT
SSEQLQNYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLTESEARYSSQLAQMQCMITN
VEAQLAEIRADLERQNQEYQVLLDVRARLEGEINTYRSLLESEDCKLPCNPCSTPSCTPC
VPSPCVPRTICVPRTVGVPCSPCPQGRY
Download sequence
Identical sequences G1RIE8
XP_003279472.1.23891 ENSNLEP00000013004 ENSNLEP00000013004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]