SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013007 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000013007
Domain Number - Region: 24-55
Classification Level Classification E-value
Superfamily RING/U-box 0.00706
Family RING finger domain, C3HC4 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013007   Gene: ENSNLEG00000010636   Transcript: ENSNLET00000013644
Sequence length 277
Comment pep:known_by_projection supercontig:Nleu1.0:GL397514.1:796134:811664:-1 gene:ENSNLEG00000010636 transcript:ENSNLET00000013644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPALCPACNSTLSGKLD
IVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQ
MEKIYTQQIQSKDVELTSMKGEITSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDS
LRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFA
GSPTAPEPSNSFFSFVSPSGELEQQQVSSRAFKVKRI
Download sequence
Identical sequences G1RIF1
ENSNLEP00000013007 ENSNLEP00000013007 XP_003280933.1.23891 XP_012353412.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]