SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013012 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013012
Domain Number 1 Region: 664-796
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000179
Family Synaptotagmin-like (S variant) 0.0061
Further Details:      
 
Domain Number 2 Region: 22-56
Classification Level Classification E-value
Superfamily WW domain 0.00000000138
Family WW domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013012   Gene: ENSNLEG00000010629   Transcript: ENSNLET00000013649
Sequence length 1179
Comment pep:known_by_projection supercontig:Nleu1.0:GL397338.1:4182544:4419979:1 gene:ENSNLEG00000010629 transcript:ENSNLET00000013649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSWIDPRDRLTKPLSFADCVGDELPWGWEAGFDPQIGVYYIDHINKTTQIEDPRKQWRGE
QEKMLKDYLSVARDALRTQKELYHVKEQRLALALDEYVRLNDAYKEKSSSRTSLFSGSSS
STKYDPDILKAEISTTRLRVKKLKRELSQMKQELLYKEQGFETLQQIDKKMSGGQSGYEL
SEAKAILTELKSIRKAISSGEKEKQDLMQSLAKLQERFHLEQNIGRSEPDLRCSPVNSHL
SLSRQTIDAGSQTRISGDIGVRSRSNLAEKVRLSLQYEEAKRSMANLKIELSKLDSEAWP
GALDIEKEKLMLINEKEELLKELQFVTPQKRTQDELEHLEAERQRLEEELLSVRGAPSRA
LAERLRSEERRKELLQKLEETTKLTTYLHSQLKSLSASTLSMSSGSSLGSLASSRGSLNT
SSRGSLNSLSSTELYYSSQSDQIDVDYQYKLDFLLQEKSGYIPSGPITTIHENEVVKSPS
QPGQSGLCGVAAAATGHTPPLAEAPKSVASLSSRSSLSSLSPPGSPLVLEGTFPMSSHDA
SLHQFTADFEDCELSSHFADISLIENQILLDSDSGGASQSLSEDKDLSECAREPLYEGTA
DVEKSLPKRRVIHLLGEKTTCVSAAVSDESVAGDSGVYEAFVKQPSEIEDVTYSEEDVAI
VETAQVQIGLRYNAKSSSFMVIIAQLRNLHAFLIPHTSKVYFRVAVLPSSTDVSCLFRTK
VHPPTESILFNDVFRVAISQTTLQQKTLRVDLCSVSKHRREECLAGTQISLADLPFSSEV
FTLWYNLLPSKQMPCKKNDENEDSVFQPNQPLVDSVDLDAVSALLARTSAELLAVEQELA
QEEEEESGQEEQRGPDGDWLNSYFLCYWELKDDVFTRLRNHRLTMLREASDEIVAEKETE
VELPEDSSCTEDLSSCTSVPEMNEDGNRKENNCAKDLRSQPPTGTPTLIDKETNTDEAAN
DNMAVRPKERSSLSSRQRPFVRSSVIVRSQTFSPGERSQYICRLNRSDSDSSTLAKKSLF
VRNSTERRSLRVKRTVCQSVLRRTAQECPVRTSLDLELDLQASLTRQSRLNDELQALRDL
RQKLEELKAQGETDLPPGVLEDERFQKLLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDV
CRLREQSQKVPRQVQSFREKIAYFTRAKISIPSLPADDV
Download sequence
Identical sequences ENSNLEP00000013012 ENSNLEP00000013012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]