SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013104 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013104
Domain Number 1 Region: 1308-1385
Classification Level Classification E-value
Superfamily Immunoglobulin 5.91e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 923-996
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000088
Family I set domains 0.049
Further Details:      
 
Domain Number 3 Region: 706-759
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000017
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 419-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 571-625
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 6 Region: 474-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 1425-1482
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000654
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 8 Region: 75-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 9 Region: 760-819
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000484
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 815-880
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 11 Region: 1486-1543
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000523
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 12 Region: 1599-1654
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000068
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 13 Region: 341-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 14 Region: 647-703
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000562
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 
Domain Number 15 Region: 1206-1283
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000391
Family I set domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013104   Gene: ENSNLEG00000010693   Transcript: ENSNLET00000013746
Sequence length 1690
Comment pep:known_by_projection supercontig:Nleu1.0:GL397317.1:540089:942202:-1 gene:ENSNLEG00000010693 transcript:ENSNLET00000013746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWTSPWWLLIGMVFMHSTLLQTTAEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRY
DDQTSRNTRSDEDKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSN
HDCPPDAEDFRAQQCSAYNDVQYQGRYYEWLPRYNDPAALCALKCHARGQNLVVELAPKV
LDGTRCNTDSLDMCISGICQAVGCDRQLGSNAKEDNCGVCAGDGSTCRLVRGQSKSHVSP
EKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSPGVFVVENTTVEFQR
GSERQTFKIPGPLMADFIFKTRYTAAKDSVFQFFFYQPISHQWRQTDFFPCTVTCGGGYQ
LNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLP
RWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP
KWIAMEWSQCTVTCGRGLRYRVVLCINHRGEHVGGCNPQLKLHIKEECVIPIPCYKPKEK
SPVEAKLPSLKQAQELEETRIATEEPTFIPEPWSACSTTCGPGVQVREVKCRVLLTFMQT
ETELPEEECEGPKLPTERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATC
LGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSATCG
VGIQTRDVYCLHPPDTPAPPEECRDEKPHALQACNQFDCPPGWHIEEWQQCSRTCGGGTQ
NRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCGVGIQ
RRKQVCQRLTAKGRRVPLSEMMCRDLPGLPLVRSCQMPECSKIKSEMKTKLGEQGPQILS
VQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQNSKRLG
ITKSGSLKIHSLAAPDIGVYRCIAGSAQETVVLKLIGTDNRLIARPALREPMREYPGMDH
HEANSLGVAWHKMRQMWNNKNDLYLDDDHISNQPFLRALLGHCSNSAGNTNSWELKNKQF
EAAVKQGAYSMDTAQFDELIRNMSQLMETGEVSDDLASQLIYQLVAELAKAQPTHMQWRG
IHEEMPPAAQLRGETGSVSQSSNAKNSGKLTFKPKGPVLMRQSQPPSISFNKTINSRIGN
TVYITKRTEVISILCDLITPSEATYTTKDGPLLQPSVKIILDGTGKIQIQNPTRKEQGIY
ECSVANHLGSDAESSSVLYAEAPVILSVERNITKPEHNHLSVVVGGIVEAALGANVTIRC
PVKGVPQPNITWLKRGGSLSGNVSLLFNGSLLLQNVSLENEGSYICTATNALGKAVATSV
LHLLERRWPESRIVFPQGHKKYVLQATNTRTNSNDPTGEPLPQEPFWEPGNWSHCSATCG
HLGARIQRPQCVMANGQEVSEALCDHLQKPLARFQPCNIRDCPARWFTSVWSQCSVSCGE
GYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCLGHQCVQWEPGNQCPGRCMGRA
VRMQQRHTACQHNSPDSNCDDRRRPTLRRNCTSGACDVCWHAGPWKPCTAACGRGFQSRK
VDCIHTRSCKPVAERHCVQKKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDLYK
QRCCQSCHEG
Download sequence
Identical sequences ENSNLEP00000013104 ENSNLEP00000013104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]