SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013115 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013115
Domain Number 1 Region: 223-365
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-26
Family Cadherin 0.0000453
Further Details:      
 
Domain Number 2 Region: 456-582
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-26
Family Cadherin 0.00032
Further Details:      
 
Domain Number 3 Region: 347-463
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-18
Family Cadherin 0.00022
Further Details:      
 
Domain Number 4 Region: 16-147
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-17
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 136-235
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000385
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 579-672
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000186
Family Cadherin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013115   Gene: ENSNLEG00000010747   Transcript: ENSNLET00000013757
Sequence length 703
Comment pep:known_by_projection supercontig:Nleu1.0:GL397346.1:3599845:4555675:1 gene:ENSNLEG00000010747 transcript:ENSNLET00000013757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWFSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKGNDKLRYEVSS
PYFKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELIIVGGKDIQGSLQDIFKFART
SPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGVDQDPKGIFRI
NENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIFREGPY
IGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFYIDPEKGDIVT
VVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKKEFQA
TVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPKTNEGMLSVVKPL
DYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQENI
SVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVDNSV
YTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKD
LHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMT
NITDLRVQVCSCRNSKVDCNAAGALRFSLPSLLLLSLFSLACL
Download sequence
Identical sequences ENSNLEP00000013115 ENSNLEP00000013115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]