SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013126 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013126
Domain Number 1 Region: 35-140
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-23
Family V set domains (antibody variable domain-like) 0.00094
Further Details:      
 
Domain Number 2 Region: 331-413
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-17
Family I set domains 0.001
Further Details:      
 
Domain Number 3 Region: 143-234
Classification Level Classification E-value
Superfamily Immunoglobulin 6.01e-17
Family I set domains 0.0061
Further Details:      
 
Domain Number 4 Region: 233-325
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000941
Family I set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013126   Gene: ENSNLEG00000010744   Transcript: ENSNLET00000013768
Sequence length 523
Comment pep:known_by_projection supercontig:Nleu1.0:GL397519.1:441418:461236:-1 gene:ENSNLEG00000010744 transcript:ENSNLET00000013768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHLSAPLHRVRVLWQGLLLTVSLLTFWNPPTTAQLTIESTPFNVAKGKEVLLLVHNLPQ
NRIGYTWYKGERVYGNHLIVAYAIGTAQATPGPAYSSRETVYPNASLLIQNVTQNDTGFY
TLQVIKSDLVNEEVIGQFHVYPELPKPSITSNNSNPEEDKDAVTFTCEPEAQDTTYLWWV
NGQSLPVSPRLQLSNGNKTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTP
TISPSHTYRPEANLNLSCYAASNPPAQYSLINGTFEQSTQSSLIPNITVNSSESYTCHAN
NLVTGRNRTTVKTIIDSELSPVVAQPQIKASKTTVTEDKDSVNLTCSTNDTGISISWFFN
NQSLPSSERMKLSQGNTTLSINPVKREDAGKYWCEVFNPISKNQSDPIMLTVNYNDPSPE
NGLSPGAIAGIVIGVLALVVLIAVALACFLHFKKTGRASDQRDLTEHKPSVSNHTQVHSN
DPPNKMNEVTYSTNFEAQQPTQPTSASPSPTATEIIYSEVKKK
Download sequence
Identical sequences ENSNLEP00000013126 ENSNLEP00000013126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]