SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013128 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013128
Domain Number 1 Region: 143-232
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-17
Family I set domains 0.006
Further Details:      
 
Domain Number 2 Region: 238-311
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000562
Family I set domains 0.0065
Further Details:      
 
Domain Number 3 Region: 35-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000014
Family V set domains (antibody variable domain-like) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013128   Gene: ENSNLEG00000010809   Transcript: ENSNLET00000013770
Sequence length 330
Comment pep:known_by_projection supercontig:Nleu1.0:GL397519.1:513149:523567:-1 gene:ENSNLEG00000010809 transcript:ENSNLET00000013770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPISAPSCRWCIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEILLLVHNLPQ
DPLGYNWYRGETVDANRRIIGYVINKLTTPGPAYSSRETVYPNASLLMXXXXXXXXXXXX
PAVIKLNLMNEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVALTCEPETQNTTYLWWVN
GQSLPVSPRLQLSNGNRTLTLLSVTRNDAGPYECEIQNPVSANFSDPVTLNVLYGPDAPT
IFPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQHTQKLFIPNITAKNSGSYACHA
TNSATGRNRTTVRMITVSDALVQGSSPGLS
Download sequence
Identical sequences ENSNLEP00000013128 ENSNLEP00000013128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]