SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013130 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013130
Domain Number 1 Region: 9-254
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.51e-18
Family Rhodopsin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013130   Gene: ENSNLEG00000010811   Transcript: ENSNLET00000013772
Sequence length 289
Comment pep:known_by_projection supercontig:Nleu1.0:GL397426.1:2286789:2287745:1 gene:ENSNLEG00000010811 transcript:ENSNLET00000013772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGLFGLWRTFDSVVFYLTLIVGLGGLVGNGLVLWNLGFHIKKGPFSVYLLHLAAADFLF
LSCHVGFSVAQAALGAQDTLYFVLTFLWFAVGLWLVVAFSVERCLSDLFPACYQGCRPRH
TSVILCALVWALTLPAVLLPANACGLLHNSARPLVCLRYHVASVTWFLVLACVAWTAGVV
LFVWVTCCSTRPRPRLYGIVLGALLLLFFCGLPLVLYWSLQPLLNFLLPMFSPLATLLAC
VNSSSKPLIYXXXXRQPGKREPLRVVLWRALGEGAELSARGQSLPMGLL
Download sequence
Identical sequences G1RIS4
XP_003278091.1.23891 ENSNLEP00000013130 ENSNLEP00000013130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]