SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013147 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013147
Domain Number 1 Region: 35-140
Classification Level Classification E-value
Superfamily Immunoglobulin 1.61e-24
Family V set domains (antibody variable domain-like) 0.00032
Further Details:      
 
Domain Number 2 Region: 322-414
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000681
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 146-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000712
Family I set domains 0.0047
Further Details:      
 
Domain Number 4 Region: 257-335
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000028
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013147   Gene: ENSNLEG00000010810   Transcript: ENSNLET00000013790
Sequence length 431
Comment pep:novel supercontig:Nleu1.0:GL397519.1:588471:805548:-1 gene:ENSNLEG00000010810 transcript:ENSNLET00000013790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLSAPPCTQRITWKGLLLTASLLNFWNPPTTAQVTIEAQPPKLSEGKDVLLLVHNLPQ
NLTGYTWYKGQMTDLYHYITSYVVDNDIIISGPAYTGRETVYSNASLLIQNVTQEDTGPY
TLHIIKRGDETREATGNFTVTLYLKTPKPSISSSKLNPREAMEAVILTCDPETPDASYLW
WMNGQSLPMTHRLKLYETNRTLILFGVTKDIAGPYECEIRNPVSASRSDPVTLNLLPKLP
NPYIIINNLNPRENKDVLAFTCEPKSENHTYRWWLNGRRLPISPRVRRPIKNRTLILPSV
TRNERGPYECEIRDRYGGIRSDPVTLNVLYGPDLPSIYPSVGYYRSGEKLYLSCSADSNP
PAEYSWTINGKFQQSGQKLFIPQITTKHSGLYACSVRNSATGKESSKSITVKVIAPSGTG
HLPGINPSEQP
Download sequence
Identical sequences ENSNLEP00000013147 ENSNLEP00000013147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]