SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013195 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013195
Domain Number 1 Region: 618-899
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.29e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000206
Further Details:      
 
Domain Number 2 Region: 29-193
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-29
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 207-385
Classification Level Classification E-value
Superfamily Fibronectin type III 6.15e-24
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 4 Region: 387-470
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000233
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013195   Gene: ENSNLEG00000010869   Transcript: ENSNLET00000013844
Sequence length 934
Comment pep:known_by_projection supercontig:Nleu1.0:GL397560.1:563817:595302:-1 gene:ENSNLEG00000010869 transcript:ENSNLET00000013844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGGGLGLWGNLVLLGLCSWTGARAAAPNPVRNLTVEAQTTSSISLRWEVPDGPDPQN
CTYWVQCTGDGGRTETRTTRDTRVTVDGLGPGSLYICSVWVEKDGVNSSAENVTSATAPN
PVRNLRVEAQTNSSISLSWEAPDGPDPQNSTYWVEYTGDGDRMETRSTADTNITVDGLEP
GSLYVFSVWVWKNGMNSSRETRNASTAPNPVRNLRVEAQTNSSIALTWEARDGPDPQNST
YWVEYTGDGDRMETRSTADTNITVDGLEPGSLYVFSVWVWKNGMNSSRETRNASTVPNAV
TSLRKQDWTNSSIALHWTAPQGPGQSSYTYWVSWIGEGMTDPRTQSTSGTDITLKELEAG
SLYHLTVWAERNEVRGYNSTLTAATAPSESQISRTQTKNSVTLWWKAPGDPHSQLYVYWV
QWASKGRPQRGQDPQANWANQTSRTNETWYKVEALEPGTLYNFTVWAERNDVASSTQSLC
ASTYPDAVTITSCVSTSAGYGVILTWSCPQGGYEAFELEVGGQRGFQDRSSCGEAVSVLG
LGPAQSYPATITTIWDGMKVVSLSVICHTESAGVIAGATVGILLFLILVVLLIFFLKRRN
KKQQKPELRDLVFSSPGDIPAEDFADHVRKNEKDSNCGFADEYQQLSLVSHSQSQMVASA
SENNAKNRYRNVLPYDWSRVPLKPIHEEPGSDYINAXXXXGLRSPQEFIATQGPLPQTVG
DFWRLVWEQQSHTLVMLTNCMEAGQVRCEHYWPVDSQPCTHGHLRVTLVGEEVMENWTVR
ELQLLQVEEQKTLSLRQFHYQAWPDHGVPSSPDNLLAFWRMLRQWLDQTTEGGPPIVHCS
AGVGRTGTLIALDVLLRQLQSQGLLGPFNFVRKMRESRPLMVQTEAQYVFLHQCILRFLQ
QSAQAPAKKEVTYENVENLIYENVAAIQAHELEV
Download sequence
Identical sequences ENSNLEP00000013195 ENSNLEP00000013195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]