SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013210 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013210
Domain Number 1 Region: 101-192,223-475,575-641
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.89e-30
Family LacY-like proton/sugar symporter 0.08
Further Details:      
 
Domain Number 2 Region: 497-547
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000137
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013210   Gene: ENSNLEG00000010874   Transcript: ENSNLET00000013861
Sequence length 724
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:962068:1027555:-1 gene:ENSNLEG00000010874 transcript:ENSNLET00000013861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSASSSDPQRENSQPQELQKPQEPQKSPE
PSLPSAPPNVSEEKLRSLSLSEFEEGPYGWRNFHPQCLQRCNTPRGFLLHYCLLAVTQGI
VVNGLVNISISTIEKRYEMKSSLTGLISSSYDISFCLLSLFVSFFGERGHKPRWLAFAAF
MIGLGALVFSLPQFVSGEYKLGSLFEDTCVTTRNSTSCMSSTSSLSNHLYVFILGQLLLG
AGGTPLYTLGTAFLDDSVPTHKSSLYIGTGYAMSILGPAIGYVLGGQLLTIYIDVAMGES
TNVTEDDPRWLGAWWIGFLLSWIFAWSLIIPFSCFPKHLPGTAEIQAGKTSQAHQSNTNA
DAKFGKSIKDFPAALKNLMKNAVFMCLVLSTSSEALITTGFATFLPKFIENQFGLTSSFA
ATLGGAVLIPGAALGQILGGFLVSKFKMTCKNTMKFALFTSGVALTLSFVFIYAKCENEP
FAGVSESYNGTGELGNLIAPCNANCNCLRSYYYPVCGDGVQYFSPCFAGCSNPVAHRKPK
VYYNCSCIERKTEITSTAETVGFEAKAGKCETHCANLPIFLCIFFIVIIFTFMAGTPITV
SILRCVNHRQRSLALGIQFMVLRLLGTIPGPIIFGFTIDSTCILWDINDCGIKGACWIYD
NIKMAHMVVAISVTCKVITMFFNGFAIFLYKPPPSATDVSFHKENAVVTNVLAEQDLNKI
VKEG
Download sequence
Identical sequences G1RJ03
ENSNLEP00000013210 ENSNLEP00000013210 XP_003259847.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]