SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013222 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013222
Domain Number 1 Region: 29-148,339-664
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.7e-73
Family Integrin alpha N-terminal domain 0.0000627
Further Details:      
 
Domain Number 2 Region: 167-360
Classification Level Classification E-value
Superfamily vWA-like 4.9e-52
Family Integrin A (or I) domain 0.000000012
Further Details:      
 
Domain Number 3 Region: 667-810
Classification Level Classification E-value
Superfamily Integrin domains 1.83e-33
Family Integrin domains 0.00087
Further Details:      
 
Domain Number 4 Region: 813-939
Classification Level Classification E-value
Superfamily Integrin domains 4.24e-22
Family Integrin domains 0.01
Further Details:      
 
Domain Number 5 Region: 945-1145
Classification Level Classification E-value
Superfamily Integrin domains 1.57e-20
Family Integrin domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013222   Gene: ENSNLEG00000010767   Transcript: ENSNLET00000013874
Sequence length 1179
Comment pep:known_by_projection supercontig:Nleu1.0:GL397396.1:2484013:2654030:1 gene:ENSNLEG00000010767 transcript:ENSNLET00000013874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRPRARPGVAVACCWLLTVVLRCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPENRTGDVYKCPVGRGESLPCIKLDLPVNTSIPNVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVRECSTQLDIVIVLDGS
NSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTKEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKASQIIIPRNTT
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQT
LSGEQIGSYFGSILTTIDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQM
SLEPIKQTCCSSRQHNSCTKENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHG
GAVYIYHGSGKTIRKEYAQRIPSGGDGETLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDESLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVT
FKILFQFNTSYLMENVTIYLSATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
ISIAANETVPEIINSTEDIGNEINIFYLIRKSGPFPMPELKLSISFPNMTSNGYPVLYPT
GLSSSDNANCRPHVFEDPFSTTSGKKMTTSTDHLRRGTILDCNTCKFATITCNLTPSDVS
QVNVSLILWKPTFIKSYFSSLNLTIRGELQSENTSLVLSSSNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
Download sequence
Identical sequences G1RJ15
XP_003276564.1.23891 ENSNLEP00000013222 ENSNLEP00000013222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]