SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013234 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013234
Domain Number 1 Region: 35-140
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-24
Family V set domains (antibody variable domain-like) 0.00035
Further Details:      
 
Domain Number 2 Region: 338-414
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000585
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 255-332
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000705
Family I set domains 0.022
Further Details:      
 
Domain Number 4 Region: 147-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000001
Family I set domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013234   Gene: ENSNLEG00000010828   Transcript: ENSNLET00000013887
Sequence length 426
Comment pep:novel supercontig:Nleu1.0:GL397519.1:930440:950863:-1 gene:ENSNLEG00000010828 transcript:ENSNLET00000013887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLSAPPCTQRITWKGFLLTASLLNFWNPPTSAQVTIEAQPPKLSEGKDVLLLVHNLPQ
NLTGYTWYKGQMTDLYHYITSYVVDNDIIISGPAYTGRETVYSNASLLIQNVTWEDTGPY
TLHIIKRGDETREATGNFTITLYPETPKPSISSSNLKPREAMEVVILTCDPETPDASYLW
WMNGQSLPVTHRLQLSESNRTLILFGVTKDIAGPYECEIRNPVSASRSDPVTLNLLPKLP
RPYITIDNLNPRENKDVLTFTCEPKSENYTYIWWLKGQSLPISPRVKRPIENRILILPSV
TRNETGPYECQIRDRYGGFSSDPVTLNVLYGPDLPSIYPSFTYYHKGENLSLSCFADSNP
PAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSMTVKVSGKWVPA
SLAIGF
Download sequence
Identical sequences ENSNLEP00000013234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]