SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013256 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013256
Domain Number 1 Region: 109-192,224-480,580-683
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.31e-29
Family Glycerol-3-phosphate transporter 0.048
Further Details:      
 
Domain Number 2 Region: 498-549
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000339
Family Ovomucoid domain III-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013256   Gene: ENSNLEG00000010892   Transcript: ENSNLET00000013911
Sequence length 719
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:1093243:1222163:-1 gene:ENSNLEG00000010892 transcript:ENSNLET00000013911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEGVARHPGGQDEAPKGVEPREAARARPAKERRARGTPKSSKPRKKYRYLRLLPEALIR
FGGFRKRKKAKSSVSKKPGEVDDSLEQPCGLGCLVSPCCECCNNIRCFMIFYCILVTCQG
VVFGLTDVSIGDFQKEYHLKTIDKLALEMSYDISSGLVAIFIAFYGDRKKVIWFVASSFL
IGLGSLLCAFPSINEENKQSKVGIEDICEEIKVVSGCQRSGVSFQSKYLSFFTLGQTVQG
IAGMPLYILGITFIDENVATHSAGIYLGIAECTSMFGYAMGYVLAAPLVKVPENSTSATN
TTDNNGSPEWLWTWWINYLFAAVFAWCTLIPLSCFPNNMPGSTRIKARKRKQLHLFDSKL
KNLELGTSIKDLCTGLWILMKNPVFICLALSKATEYLVIIGASEFLPIYLENQFILTPTV
ATTLAGLVLIPGGALGQLLGGVIVSTLEMSCKALMRFIMVTSVISLILLVFIIFVRCNPV
QFAGINEDYDGTGQLGNLTAPCNEKCRCSTSIYSSICGRDDIEYFSPCFAGCTYSKAQNQ
NKMYYSCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPLFIAFIFSTLIFSGFSGVPII
LAITRVVPDKLRSLALGVSYVILRIFGTIPGLSIFKMSGETSCILRDVNKCGHPGRCWIY
NKTKMAFLLVGICFLCKLCTIIFTTIAFFIYKHRLNENTDVPDVTVKNPKVKKKEETNF
Download sequence
Identical sequences A0A2I3FWQ0
ENSNLEP00000013256 ENSNLEP00000013256 XP_003259848.1.23891 XP_003259849.1.23891 XP_012360731.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]