SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013277 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013277
Domain Number 1 Region: 62-251
Classification Level Classification E-value
Superfamily L domain-like 8.35e-30
Family Ngr ectodomain-like 0.0029
Further Details:      
 
Domain Number 2 Region: 262-345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000677
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 431-500
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000135
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013277   Gene: ENSNLEG00000010940   Transcript: ENSNLET00000013931
Sequence length 623
Comment pep:known_by_projection supercontig:Nleu1.0:GL397364.1:6655095:6664462:-1 gene:ENSNLEG00000010940 transcript:ENSNLET00000013931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVALGMLWLLALGWTPQARGFCPSQCSCSLHIMGDGSKARTVVCNDPDMTLPPASIPLD
TSRLRLERTAIRRVPGEAFRPLGRLEQLWLPYNALSELNALMLRGLRRLRELRLPGNRLA
AFPWAALRDAPQLRLLDLQANRLSAVPPEAARFLENLTFLDLSSNQLMRLTQELIVSWAH
LKTGIFPPGHHPRLVLGLQDNPWACDCRLYDLVHLLDGWAPKLAFIETELRCASPRSLAG
VAFSQLELRKCQGPELHPGVASIRSLLGGTALLRCGATGVPGPEMSWRRANGKPLNGTVH
QEVSSDGTSWTLLGLPAVSHLDSGDYICQAKNFLGASETVISLIVTEPQTSTEHSGSPGT
LWARTGGGGEAAVYNNKLVARHVPQIPKPAVLATGPSVPSTKEELTLERFQMDALGELSD
GRAGPSEARMVRSVKVVGDTYHSVSLVWKAPQAKNTTAFSVLYAVFGQHSMRRVIVQPGK
TRVTITGLLPKTKYVACVCVQGLVPRKEQCVIFSTNEVVDAEHTQQLINVVVISVAVVIA
LPLTLLVCCGALQRRCRKCFNRDSPEATVTYVNLERLGHSEDGLEELSRHSVSEADRLLS
ARSSVDFQAFGVKGGRRINEYFC
Download sequence
Identical sequences G1RJ70
ENSNLEP00000013277 ENSNLEP00000013277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]