SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013309 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000013309
Domain Number - Region: 16-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000105
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013309   Gene: ENSNLEG00000010968   Transcript: ENSNLET00000013963
Sequence length 253
Comment pep:known_by_projection supercontig:Nleu1.0:GL397480.1:494947:496528:1 gene:ENSNLEG00000010968 transcript:ENSNLET00000013963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKVCGC
RAREWEGRXXXXXXXXXXWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYE
HNTSVVKKIHIEVVDKGESGAACPFTVSHWARWRDRWQVADRTGWLCAWSANRPQQQAGG
EGSSPSRPLQLWPLFPSSPRRGQSMPLPHRHSGYRTQLCHLCCMTSGRCLLSLSQRVVLG
SPRIIICVSRGVV
Download sequence
Identical sequences ENSNLEP00000013309 ENSNLEP00000013309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]