SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013350 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013350
Domain Number 1 Region: 30-149,341-649
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.79e-67
Family Integrin alpha N-terminal domain 0.0000408
Further Details:      
 
Domain Number 2 Region: 169-364
Classification Level Classification E-value
Superfamily vWA-like 4.45e-52
Family Integrin A (or I) domain 0.00000000672
Further Details:      
 
Domain Number 3 Region: 934-1135
Classification Level Classification E-value
Superfamily Integrin domains 5.13e-41
Family Integrin domains 0.0023
Further Details:      
 
Domain Number 4 Region: 792-929
Classification Level Classification E-value
Superfamily Integrin domains 5.23e-25
Family Integrin domains 0.0038
Further Details:      
 
Domain Number 5 Region: 653-791
Classification Level Classification E-value
Superfamily Integrin domains 5.13e-17
Family Integrin domains 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013350   Gene: ENSNLEG00000010910   Transcript: ENSNLET00000014004
Sequence length 1181
Comment pep:known_by_projection supercontig:Nleu1.0:GL397396.1:2690625:2798297:1 gene:ENSNLEG00000010910 transcript:ENSNLET00000014004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGRTGATPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPAAQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDVGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYFSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNDLKKEEGRVYLFTIKKGILSQH
QFLEGPEGIENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEAS
FTPEKITLLNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKV
FSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCNNVTCWLKDLHMKGEYFVNVTTRIW
NGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSII
AGILLLLALVAILWKLGFFKRKYEKMTKNPDETDETTELSS
Download sequence
Identical sequences A0A2I3HG50
XP_003276566.1.23891 ENSNLEP00000013350 ENSNLEP00000013350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]