SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013354 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013354
Domain Number 1 Region: 567-744
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-41
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 372-564
Classification Level Classification E-value
Superfamily Fibronectin type III 7.74e-26
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 3 Region: 174-224
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000778
Family B-box zinc-binding domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000013354
Domain Number - Region: 205-296
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0706
Family HBL-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013354   Gene: ENSNLEG00000010971   Transcript: ENSNLET00000014008
Sequence length 750
Comment pep:known_by_projection supercontig:Nleu1.0:GL397317.1:1781566:1832250:1 gene:ENSNLEG00000010971 transcript:ENSNLET00000014008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELGEELGLDRSTPKDFHFYHMDLYDSEDRLQLFPEENTRMRKEVVQAEMANEARGAG
DGKAQRDLQEEVDELVHLYGLEDDHELGDEFVDENIPRTGVSEYPPYVMKRRDPAREQRD
WRLSGEAVEVKDLGFGGWGPVGQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEAADVF
CVTCKTPIRAFQKVFDEHKEHEVIPLNEALESAKDEIHKNMYKLEKQIIEMENFANHLEE
VFITVEENFGKQEQNFESHYNEILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGENL
DTCKELMETIEEMCHEEKVDFIKDAVAMADRLRKFLKTKTDMEISAQPEFEDQTLDFSEV
EQLMGSINTIPAPSAPVINPQVPNSATGSSVRVCWSLYSDDTVESYQLSYRPVQDSSPGK
DRAEFTVTIKETYCSVTNLVPNTQYEFWVTAHNRAGPSPSSERAVYMTAPSPPVIKSKEI
RSCEEAVLICWESGNLNPVDSYTVELTQAESPDASGVTESVVGIPTCASLVQLQPGRSYI
IYVRALNMGGPSMRSEPATVHTIGSYFRLNKDTCHPWLTISEDGLTVVRSERRTPARELS
PSDTRFTRCVAVMGNLIPVRGHHYWEVEVDEHLDYTVGVAFEDVPKQEDLGANCLSWCMR
HTFASSRHKYEFLHNRTTPDLRVTVPPKKIGILLDYENSKLSFFNVDLSQHLYTFSCQLH
EFVHPCFSLEKPGCLKVHNGISMPKHVTFY
Download sequence
Identical sequences G1RJE7
ENSNLEP00000013354 ENSNLEP00000013354 XP_003268503.1.23891 XP_012362987.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]