SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013426 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013426
Domain Number 1 Region: 98-164
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000452
Family Ovomucoid domain III-like 0.00018
Further Details:      
 
Domain Number 2 Region: 191-239
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000707
Family Ovomucoid domain III-like 0.0086
Further Details:      
 
Domain Number 3 Region: 261-316
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000139
Family Ovomucoid domain III-like 0.0076
Further Details:      
 
Domain Number 4 Region: 27-65
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000569
Family TB module/8-cys domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013426   Gene: ENSNLEG00000011045   Transcript: ENSNLET00000014090
Sequence length 344
Comment pep:known_by_projection supercontig:Nleu1.0:GL397396.1:3183263:3188657:1 gene:ENSNLEG00000011045 transcript:ENSNLET00000014090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR
LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAP
DCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCV
VDQTNNAYCVTCNRICPEPTSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCI
KAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEA
ACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Download sequence
Identical sequences A0A096MVD6 A0A2K5LE42 A0A2K6BJE4 A0A2K6RVP7 F7AVH0 G7P7H6 H2PFJ1
ENSNLEP00000013426 ENSPPYP00000017271 9544.ENSMMUP00000006461 9600.ENSPPYP00000017271 ENSGGOP00000002927 ENSMMUP00000006461 XP_001095829.2.72884 XP_002815597.1.23681 XP_003276570.1.23891 XP_004058911.1.27298 XP_005556939.1.63531 XP_010374571.1.97406 XP_011770210.1.29376 XP_011794739.1.43180 XP_011942397.1.92194 ENSPANP00000003811 ENSPPYP00000017271 ENSGGOP00000002927 ENSNLEP00000013426 ENSMMUP00000006461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]