SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013448 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013448
Domain Number 1 Region: 34-102
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000172
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000013448
Domain Number - Region: 141-179
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00288
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013448   Gene: ENSNLEG00000011080   Transcript: ENSNLET00000014115
Sequence length 369
Comment pep:known_by_projection supercontig:Nleu1.0:GL397480.1:683567:687457:-1 gene:ENSNLEG00000011080 transcript:ENSNLET00000014115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPMLWLLLHFAAPALGFYFSIRCPSGKQCQQALLSGNDILLYCNSSGAHWYYLFTQGKK
GRLTSLTNISNMEIVPEGSLLIKDPLPSQTGLYRCWNKNGRQVVQYEIDFQDVTTLHITH
KDLGQKPLQNETLHLGSKQLIFTRWEPWQDCNLCEEPGERKRLGYCYIEEPLEEAMPCWL
YLGEVLGWSSRLRPELQVEACHVQCTNNTQLRVDYVIFDNFRLDETTEFVWLDCPLGSMY
RPVNWHANDTPLTWESQLSGWDFTTFLDPSTGGRQLQVFQPAIYKCYVQQELVAQFNPAA
SPETLEAQWRENDAQWREARKALRGRADSVLKGLKLVLLVGTVLALLGALLKFIRPSPGK
RSTQVLVVK
Download sequence
Identical sequences G1RJP1
XP_003280063.1.23891 ENSNLEP00000013448 ENSNLEP00000013448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]