SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013505 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013505
Domain Number 1 Region: 62-107
Classification Level Classification E-value
Superfamily Elafin-like 0.000000275
Family Elafin-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013505   Gene: ENSNLEG00000011098   Transcript: ENSNLET00000014175
Sequence length 220
Comment pep:known_by_projection supercontig:Nleu1.0:GL397346.1:5064694:5099521:1 gene:ENSNLEG00000011098 transcript:ENSNLET00000014175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTSVGPGSRRRQIIRAVCLLLLLFHAGSAKNIWKRALPARLAEKSHAEEAGAPGGPRQ
PRADRCPPPPRTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPAVLDWLVQP
KPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQC
VKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQRHFQ
Download sequence
Identical sequences G1RJU8
XP_003272540.1.23891 XP_012360705.1.23891 ENSNLEP00000013505 ENSNLEP00000013505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]