SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013508 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013508
Domain Number 1 Region: 139-243
Classification Level Classification E-value
Superfamily Fibronectin type III 4.87e-36
Family Fibronectin type III 0.00000186
Further Details:      
 
Domain Number 2 Region: 41-145
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-26
Family Fibronectin type III 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013508   Gene: ENSNLEG00000011112   Transcript: ENSNLET00000014178
Sequence length 295
Comment pep:known_by_projection supercontig:Nleu1.0:GL397278.1:27003675:27016104:-1 gene:ENSNLEG00000011112 transcript:ENSNLET00000014178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
LINQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYLAGNVESTGS
AGEPLYENSPEFTPYLETNLGQPTIQSFEQLGTKVNVTVQDEWTLVRSNDTFLSLRDVFG
KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTANRKSADSPVE
CMGHEKGEFREIFYIIGAVVFVVIILVIILAVSLHKCRKAGVGQSWKENSPLNVS
Download sequence
Identical sequences G1RJV1
ENSNLEP00000013508 XP_003260115.1.23891 ENSNLEP00000013508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]