SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013514 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013514
Domain Number 1 Region: 348-772
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.32e-108
Family Phosphofructokinase 0.00000731
Further Details:      
 
Domain Number 2 Region: 22-357
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.92e-100
Family Phosphofructokinase 0.000000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013514   Gene: ENSNLEG00000011084   Transcript: ENSNLET00000014184
Sequence length 784
Comment pep:known_by_projection supercontig:Nleu1.0:GL397271.1:1556096:1626422:1 gene:ENSNLEG00000011084 transcript:ENSNLET00000014184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAARNLLQRGIT
NLCVIGGDGSLTGANIFRKEWSGLLEELARNGQIDNEAVQKYAYSCVAWWVHRHIDNDFA
HDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RVLPGKYLDEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSVCVL
GISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV
Download sequence
Identical sequences ENSNLEP00000013514 XP_003257627.1.23891 ENSNLEP00000013514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]