SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013521 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013521
Domain Number 1 Region: 207-302
Classification Level Classification E-value
Superfamily Immunoglobulin 3.65e-16
Family I set domains 0.03
Further Details:      
 
Domain Number 2 Region: 27-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000143
Family I set domains 0.0068
Further Details:      
 
Domain Number 3 Region: 307-398
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000856
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 116-202
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000573
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013521   Gene: ENSNLEG00000011137   Transcript: ENSNLET00000014191
Sequence length 398
Comment pep:known_by_projection supercontig:Nleu1.0:GL397411.1:3076912:3079984:-1 gene:ENSNLEG00000011137 transcript:ENSNLET00000014191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMLVVFLLLWGEASWGPSHPFAVYDPQPSLWAESESLLKPSANVTLTCQARLETPDFQL
FKNGVAQEPVHLDSPAIEHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPW
LSMTPVSWITPGLNTTAVCRGGLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHRAGNY
SCSYRTHGEGALSEPSATVTVEELAAPPPPVLMHRGESTQVLRPGSEVTLTCMAPLSGVD
FQLRRGEKELLVPRSSTSPDRIFFHLNPVALGDGGHYTCRYRLHDNQNSWSGDSAPVELI
LSDETLPAPEFSSEPESGRALRLRCLAPLEGARFALVREDGGGRRVHRFQSPAGTEALFE
LHNISVADSANYSCVYVDLKPPFAGSAPSERLELRVDG
Download sequence
Identical sequences ENSNLEP00000013521 ENSNLEP00000013521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]