SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013526 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013526
Domain Number 1 Region: 26-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000504
Family V set domains (antibody variable domain-like) 0.0014
Further Details:      
 
Domain Number 2 Region: 209-290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000649
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 259-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000188
Family C2 set domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013526   Gene: ENSNLEG00000011129   Transcript: ENSNLET00000014197
Sequence length 501
Comment pep:known_by_projection supercontig:Nleu1.0:GL397480.1:746204:763381:1 gene:ENSNLEG00000011129 transcript:ENSNLET00000014197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFLTALPLFWIMISASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPTVVHGVWY
FNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSNVSPELGGKYYFRGD
LGGYNQYTFSEHSVLDIISESPAVVQAPGAGAAGREGVWPEGLPAPSLAGLDGSQDWGHL
SLPEPLAGRRSTSWVLTINAPWKPTVNGTMVAVEGETVSILCSTQSNPDPILTIFKEKQI
LATVIYESELQLELPAVSPEDDGEYWCVAENQYGQRATAFNLSVEFAPVLLLESHCAAAR
DTVQCLCVVKSNPEPSVAFELPSRNVTVNESEREFVYSERSGLVLTSILTLRGQAQAPPR
VICTARNLYGAKSLELPFQGAHRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKKNVTES
PSFSAGDNPPVLFSSDFRISGAPEKYESERRLGSERRLLGLRGEPPELDLSYSHSDLGKR
PTKDSYTLTEELAEYAEIRVK
Download sequence
Identical sequences ENSNLEP00000013526 ENSNLEP00000013526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]