SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013660 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013660
Domain Number 1 Region: 274-449
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.48e-17
Family RNA methyltransferase FtsJ 0.02
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000013660
Domain Number - Region: 627-720
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.000173
Family mRNA capping enzyme 0.09
Further Details:      
 
Domain Number - Region: 754-785
Classification Level Classification E-value
Superfamily WW domain 0.0482
Family WW domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013660   Gene: ENSNLEG00000011192   Transcript: ENSNLET00000014337
Sequence length 835
Comment pep:known_by_projection supercontig:Nleu1.0:GL397405.1:1067999:1118524:1 gene:ENSNLEG00000011192 transcript:ENSNLET00000014337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRRTDPECTAPIKKQKKRVAELALSLSSTSDDEPPSSVSHGAKASTTSLSGSDSETEGK
QHSSDSFDDAFKADSLVEGTSSRYSMYNSVSQKLMAKMGFREGEGLGKYSQGRKDIVEAS
SQKGRRGLGLTLRGFDQELNVDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKR
KMIIEDETEFCGEELLHSVLQCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKM
ANMDFVFDRMFTNPRDSYGKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGM
TLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVLDNTDRKGVHF
LMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLL
YCCFERVCLFKPITSRPANSERYVVCKGLKVGIDDVRDYLFAVNIKLNQLRNTDSDVNLV
VPLEVIKGDHEFTDYMIRSNESYCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWG
IPDQARVAPSSSDPKSKFFELIQGTEIDIFSYKPTLLTSKTLEKIRPVFDYRCMVSGSEQ
KFLIGLGKSQIYTWDGRQSDRWIKLDLKTELPRDTLLSVEIVHELKGEGKAQRKISAIHI
LDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVYRLEEMEKIFVRLE
MKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNEPWTMGFSKNFKKKFFYNKKTKDST
FDLPADSIAPFHICYYGRLFWEWGDGIRVHDSQKPQDQDKLSKEDVLSFIQMHRA
Download sequence
Identical sequences A0A2I3HU44
ENSNLEP00000013660 ENSNLEP00000013660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]