SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013726 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013726
Domain Number 1 Region: 753-919
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-47
Family MAM domain 0.00022
Further Details:      
 
Domain Number 2 Region: 238-328
Classification Level Classification E-value
Superfamily Immunoglobulin 6.8e-17
Family I set domains 0.0051
Further Details:      
 
Domain Number 3 Region: 342-443
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000432
Family I set domains 0.043
Further Details:      
 
Domain Number 4 Region: 48-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000105
Family I set domains 0.053
Further Details:      
 
Domain Number 5 Region: 437-536
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000008
Family I set domains 0.033
Further Details:      
 
Domain Number 6 Region: 538-634
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000025
Family I set domains 0.021
Further Details:      
 
Domain Number 7 Region: 131-216
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000101
Family I set domains 0.03
Further Details:      
 
Domain Number 8 Region: 193-239,635-743
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000216
Family Fibronectin type III 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013726   Gene: ENSNLEG00000011271   Transcript: ENSNLET00000014404
Sequence length 958
Comment pep:known_by_projection supercontig:Nleu1.0:GL397405.1:1266719:1331265:-1 gene:ENSNLEG00000011271 transcript:ENSNLET00000014404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQC
LVTGHPRPQVRWTKTQVARGQFQETSVFNETLRIERIARTQGGRYYCKAENGVGVPAIKS
IRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQD
NGVDIYEPLYTQGETKVLKLKNLRPQDYASYTCQVSVRNVCGIPDKAITFRGSPTRAPPA
LKLSVNETLVVNPGENVTVQCLLTGGDPLPQLQWSHGPGPLPLGALAQGGTLSIPSVQAR
DSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQITPDVIKESENIQLGQDLKLSCHVDA
VPQEKVTYQWFKNGKPARMSKRLLVTRNDPELPAVTSSLELIDLHFSDYGTYLCMASFPG
APVPDLSVEVNISSETVPPTISVPKGRAVVTVREGSPAELQCEVRGKPRPPVLWSRVDKE
AALLPSGLPLEETPDGKLRLERVSRDMSGTYRCQTARYNGFNVRPREAQVQLNVQSPVPP
EVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAAAEAPDH
AELLLDAVTRDSSGSYECSVSNDVGSAACLFQVSAKAYSPEFYFDTPNPTRSHKLSKNYS
YVLQWTQREPDAVDPVLNYRLSVRQLNQHNTVVKAIPVRRVEKGQLLEYILTDLRVPHSY
EVRLTPYTTFGAGDMASRIIHYTEPINSPNLSDNTCHFEDEKICGYTQDLTDNFDWTRQN
ALTQNPKRSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAKFYCVSFF
YHMYGKHIGSLNLLVRSRNKGALDTHAWSLSGNKGNVWQQAHVPISPSGPFQIIFEGVRG
PGYLGDIAIDDVTLKKGECPRKQMDPNKVVVMPGSGAPCQSSPQLWGPMAIFLLALQR
Download sequence
Identical sequences ENSNLEP00000013726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]