SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013736 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013736
Domain Number 1 Region: 130-224,267-377,415-521
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.79e-37
Family LacY-like proton/sugar symporter 0.034
Further Details:      
 
Domain Number 2 Region: 549-603
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000137
Family Ovomucoid domain III-like 0.008
Further Details:      
 
Domain Number 3 Region: 646-760
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000562
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013736   Gene: ENSNLEG00000011288   Transcript: ENSNLET00000014414
Sequence length 848
Comment pep:known_by_projection supercontig:Nleu1.0:GL397367.1:3822494:3980487:-1 gene:ENSNLEG00000011288 transcript:ENSNLET00000014414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGTGLQPGAGEQLEAPATAEAAQERCEPETFRSKSLPVLSSASCRPSLSPASGDAKPA
FGCADSSGRQELKQGPNPLAPSPSAPSASAGLGDCNHRVDLSKTFSVSSALATLQEQRCL
YVVLTDSRCFLVCMCLLTFIQALMVSGYLSSVITTIERRYSLKSSESGLLVSCFDIGNLV
VVVFVSYFGGRGRRPLWLAVGGLLIAVGAALFALPHFISPPYQVQELNASAPNDGLCQGG
NSTATLEPPACPKDSGGNNHWVYVALFICAQILIGMGSTPIYTLGPTYLDDNVKKENSSL
YLAIMYVMGALGPAVGYLLGGLLIGFYVDPRNPVHLDQNDPRFIGNWWSGFLLCAIAMFL
VIFPMFTFPKKLPPRHKKKKKKKFSVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRD
LPRAAVRILSNMTFLFVSLSYTAESAIVTAFITFIPKFIESQFGIPASNASIYTGVIIVP
SAGVGIVLGGYIIKKLKLGARESAKLAMICSGVSLLCFSTLFIVGCESINLGGINIPYTT
GPSLTMPHRNLTGSCNVNCGCKIHEYEPVCGSDGITYFNPCLAGCVNSGNLSTGIRNYTE
CTCVQSRQVITPPTVGQRSQLRVVIVKTYLNENGYAVSGKCKRTCNTLIPFLVFLFIVTF
ITACAQPSAIIVTLRSVEDEERPFALGMQFVLLRTLAYIPTPIYFGAVIDTTCMLWQQEC
GVQGSCWEYNVTSFRFVYFGLAAGLKFVGFVFIFLAWYSIKYKEDGLQRRRWREFPLSTV
SERVGHPDNARTRSCPAFSTQGEFHEETGLQKGIQCAAQTYAGPFPEAISSSADPGPEER
PAALEPPS
Download sequence
Identical sequences G1RKH9
ENSNLEP00000013736 XP_003274859.1.23891 ENSNLEP00000013736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]